Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Uniprot NO.:P0C2H1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKAWLFWSVIVLYFFIKFFDKVLDIKLFGSIQIWLDNLPIPMKILLTIALVLFLFIVFP YRGKR
Protein Names:Recommended name: Uncharacterized membrane protein SPD_2304
Gene Names:Ordered Locus Names:SPD_2304 ORF Names:orf4
Expression Region:1-65
Sequence Info:full length protein