Recombinant Streptococcus pneumoniae  ATP synthase subunit c(atpE)

Recombinant Streptococcus pneumoniae ATP synthase subunit c(atpE)

CSB-CF363331SMP
Regular price
$1,405.00 CAD
Sale price
$1,405.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Uniprot NO.:P0A307

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Synonyms:atpC Ordered Locus Names:spr1366

Expression Region:1-66

Sequence Info:full length protein

Your list is ready to share