Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P37299
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPL LGPTLEDHTPPEDKPN
Protein Names:Recommended name: Cytochrome b-c1 complex subunit 10 Alternative name(s): Complex III subunit 10 Complex III subunit XI Ubiquinol-cytochrome c reductase complex 8.5 kDa protein
Gene Names:Name:QCR10 Ordered Locus Names:YHR001W-A ORF Names:YHR001BW
Expression Region:2-77
Sequence Info:full length protein