
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)
Uniprot NO.:Q1AVI9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQQLVEQLNAQIPLEGYLTVAAIMFAIGAWGALIRRNAVVVFMCVELMINAVNLTLVAFA DFLPGAGGAGAGYTVLIIAIAAAEVAVGLAIVLAIFRTRRTVNIDEVDSLRG
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K
Gene Names:Name:nuoK Ordered Locus Names:Rxyl_1628
Expression Region:1-112
Sequence Info:full length protein