Recombinant Rotavirus A Outer capsid protein VP4,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rotavirus A Outer capsid protein VP4,partial

CSB-EP339583RFU
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P35746

Gene Names: N/A

Organism: Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

AA Sequence: ARPNEDIIISKASLWKEVQYNRDIVIRFVFANNIIKAGGLGYKWSEISYKANNYQYTYMRDGVEVVAHTTVSVNGVSVYNYNTGPLPTDFMIRNYDVLKESSFVYVDYWDDSQAFRNMVYVRSLNAELNQVRCEGGHYSFALPVGSWPVMQGGSVILTFDGVTLSTQFTDYVSLNSLRFRFRCAVSEPSFRVTGTRISNLYGLPAANPMGDQQYYEAAGRFSLILLVPSNDDY

Expression Region: 247-479aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 31.5 kDa

Alternative Name(s): Hemagglutinin

Relevance: Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. According to the considered strain, VP4 seems to essentially target sialic acid and/or the integrin heterodimer ITGA2/ITGB1

Reference: "Amino acid sequence analysis of bovine rotavirus B223 reveals a unique outer capsid protein VP4 and confirms a third bovine VP4 type." Hardy M.E., Gorziglia M., Woode G.N. Virology 191:291-300(1992)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share