Recombinant Rat Vasopressin V1a receptor(Avpr1a),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Vasopressin V1a receptor(Avpr1a),partial

CSB-RP156244r
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P30560

Gene Names: Avpr1a

Organism: Rattus norvegicus (Rat)

AA Sequence: SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK

Expression Region: 7-52aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 31.9 kDa

Alternative Name(s): AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptor

Relevance: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation.

Reference: Immunocytochemical localization of vasopressin v1a receptors in the rat pituitary gonadotropes.Orcel H., Tobin V.A., Alonso G., Rabie A.Endocrinology 143:4385-4388(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share