
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Neuroscience
Uniprot ID: P10066
Gene Names: Crygb
Organism: Rattus norvegicus (Rat)
AA Sequence: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY
Expression Region: 2-175aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 23 kDa
Alternative Name(s): Gamma-B-crystallin Gamma-crystallin 1-2
Relevance: Crystallins are the dominant structural components of the vertebrate eye lens.
Reference: "Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region." den Dunnen J.T., van Neck J.W., Cremers F.P.M., Lubsen N.H., Schoenmakers J.G.G. Gene 78:201-213(1989)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.