
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: Snca
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Rattus norvegicus (Rat)
Delivery time: 3-7 business days
Uniprot ID: P37377
AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
Tag info: N-terminal GST-tagged
Expression Region: 1-140aa
Protein length: Full Length
MW: 41.5 kDa
Alternative Name(s):
Relevance: May be involved in the regulation of dopamine release and transport.
Reference: The UCH-L1 gene encodes two opposing enzymatic activities that affect alpha-synuclein degradation and Parkinson's disease susceptibility.Liu Y., Fallon L., Lashuel H.A., Liu Z., Lansbury P.T. Jr.Cell 111:209-218(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.