Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: A4H244
Gene Names: DEFB126
Organism: Pongo pygmaeus (Bornean orangutan)
AA Sequence: SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Expression Region: 21-63aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal GST-tagged
MW: 31.9 kDa
Alternative Name(s): Defensin, beta 126
Relevance: Has antibacterial activity.Curated
Reference: Evolution and sequence variation of human beta-defensin genes.Hollox E.J., Armour J.A.L.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.