Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Others
Uniprot ID: A0A077XDV0
Gene Names: PBANKA_093100
Organism: Plasmodium berghei (strain Anka)
AA Sequence: QNIKTIFSSFTFYFFFFIFIYAFLLSIMHIFINYFFYIYLFVFNINIYISNIYTIIMTFASLIAIPFSGYIIDNIGSFLFLLLCSSFFILIAISGTIYSCVFNLRSEVIAFISFNLIGISESIIPTVIISQIPTHLCVKKNEDITAAFAIFELVSMLIVSVNNYIFGYFLINKEYLNGLYILFVFVILVISLIFLLIFTIYWKAR
Expression Region: 756-960aa
Sequence Info: Partial
Source: in vitro E.coli expression system
Tag Info: N-terminal 6xHis-tagged
MW: 27.9 kDa
Alternative Name(s):
Relevance:
Reference: "A comprehensive evaluation of rodent malaria parasite genomes and gene expression." Otto T.D., Bohme U., Jackson A.P., Hunt M., Franke-Fayard B., Hoeijmakers W.A., Religa A.A., Robertson L., Sanders M., Ogun S.A., Cunningham D., Erhart A., Billker O., Khan S.M., Stunnenberg H.G., Langhorne J., Holder A.A., Waters A.P. Janse C.J. BMC Biol. 12:86-86(2014)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.