
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P50498
Gene Names: MSA2
Organism: Plasmodium falciparum (isolate 3D7)
AA Sequence: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Expression Region: 109-246aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 41.7 kDa
Alternative Name(s): 45KDA merozoite surface antigen
Relevance: May play a role in the merozoite attachment to the erythrocyte.
Reference: Structural diversity in the 45-kilodalton merozoite surface antigen of Plasmodium falciparum.Smythe J.A., Peterson M.G., Coppel R.L., Saul A.J., Kemp D.J., Anders R.F.Mol. Biochem. Parasitol. 39:227-234(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.