Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pantoea vagans (strain C9-1) (Pantoea agglomerans (strain C9-1))
Uniprot NO.:E1SFM6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVLPVFVMFGLSFPPVFIELIISLMLFWLVKRVLTPSGIYDLVWHPALFNTALYCCVFY LVSRLLV
Protein Names:Recommended name: Protein AaeX
Gene Names:Name:aaeX Ordered Locus Names:Pvag_2816
Expression Region:1-67
Sequence Info:full length protein