
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: Q9CQU0
Gene Names: Txndc12
Organism: Mus musculus (Mouse)
AA Sequence: RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
Expression Region: 25-170aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 18.5 kDa
Alternative Name(s): Endoplasmic reticulum resident protein 19 Short name: ER protein 19 Short name: ERp19 Thioredoxin-like protein p19
Relevance: Possesses significant protein thiol-disulfide oxidase activity.
Reference: "ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins."Knoblach B., Keller B.O., Groenendyk J., Aldred S., Zheng J., Lemire B.D., Li L., Michalak M.Mol. Cell. Proteomics 2:1104-1119(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.