
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P11589
Gene Names: Mup2
Organism: Mus musculus (Mouse)
AA Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE
Expression Region: 19-180aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 20.7 kDa
Alternative Name(s):
Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
Reference: Solution structure of a recombinant mouse major urinary protein.Luecke C., Franzoni L., Abbate F., Lohr F., Ferrari E., Sorbi R.T., Rueterjans H., Spisni A.Eur. J. Biochem. 266:1210-1218(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.