Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase(lgt)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase(lgt)

CSB-CF875009LNG
Regular price
$1,745.77 CAD
Sale price
$1,745.77 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: Q9CHU9

Gene Names: lgt

Organism: Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

AA Sequence: MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN

Expression Region: 1-261aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: C-terminal 6xHis-tagged

MW: 32.6 kDa

Alternative Name(s):

Relevance: Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.

Reference: "The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403." Bolotin A., Wincker P., Mauger S., Jaillon O., Malarme K., Weissenbach J., Ehrlich S.D., Sorokin A. Genome Res. 11:731-753(2001)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share