Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
Uniprot NO.:P06821
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDRLFFKCIYRRFKYGLK GGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE
Protein Names:Recommended name: Matrix protein 2 Alternative name(s): Proton channel protein M2
Gene Names:Name:M
Expression Region:1-97
Sequence Info:full length protein