Recombinant Human Ribonucleoprotein PTB-binding 2(RAVER2),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Ribonucleoprotein PTB-binding 2(RAVER2),partial

CSB-YP872547HU
Regular price
$855.20 CAD
Sale price
$855.20 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q9HCJ3

Gene Names: RAVER2

Organism: Homo sapiens (Human)

AA Sequence: MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT

Expression Region: 1-140aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 17 kDa

Alternative Name(s): Protein raver-2

Relevance: May bind single-stranded nucleic acids.Curated

Reference: Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.DNA Res. 7:273-281(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share