Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Metabolism
Uniprot ID: P61457
Gene Names: PCBD1
Organism: Homo sapiens (Human)
AA Sequence: AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Expression Region: 2-104aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 13.9 kDa
Alternative Name(s): 4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alpha ;DCoH ;Dimerization cofactor of HNF1;Phenylalanine hydroxylase-stimulating protein;Pterin carbinolamine dehydratase ;PCD
Relevance: Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Reference: Characterization of a cofactor that regulates dimerization of a mammalian homeodomain protein.Mendel D.B., Khavari P.A., Conley P.B., Graves M.K., Hansen L.P., Admon A., Crabtree G.R.Science 254:1762-1767(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.