
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Cell Biology
Uniprot ID: P56730
Gene Names: PRSS12
Organism: Homo sapiens (Human)
AA Sequence: IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK
Expression Region: 631-874aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 43.4 kDa
Alternative Name(s): Leydin Motopsin Serine protease 12
Relevance: Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.
Reference: "Cloning and sequencing of the cDNA encoding human neurotrypsin."Proba K., Gschwend T.P., Sonderegger P.Biochim. Biophys. Acta 1396:143-147(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.