![Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7(NDUFB7)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_4ac9c034-0a23-4c96-8f7c-3b0825239770_{width}x.jpg?v=1659197178)
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: P17568
Gene Names: NDUFB7
Organism: Homo sapiens (Human)
AA Sequence: GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Expression Region: 2-137aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 43.3 kDa
Alternative Name(s): Cell adhesion protein SQM1Complex I-B18 ;CI-B18NADH-ubiquinone oxidoreductase B18 subunit
Relevance: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference: cDNA cloning of a novel cell adhesion protein expressed in human squamous carcinoma cells.Wong Y.-C., Tsao S.-W., Kakefuda M., Bernal S.D.Biochem. Biophys. Res. Commun. 166:984-992(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.