Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7(NDUFB7)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7(NDUFB7)

CSB-RP015944h
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transport

Uniprot ID: P17568

Gene Names: NDUFB7

Organism: Homo sapiens (Human)

AA Sequence: GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Expression Region: 2-137aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 43.3 kDa

Alternative Name(s): Cell adhesion protein SQM1Complex I-B18 ;CI-B18NADH-ubiquinone oxidoreductase B18 subunit

Relevance: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Reference: cDNA cloning of a novel cell adhesion protein expressed in human squamous carcinoma cells.Wong Y.-C., Tsao S.-W., Kakefuda M., Bernal S.D.Biochem. Biophys. Res. Commun. 166:984-992(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share