Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Adhesion
Uniprot ID: P07942
Gene Names: LAMB1
Organism: Homo sapiens (Human)
AA Sequence: MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVY
Expression Region: 1533-1782aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 32.2 kDa
Alternative Name(s): Laminin B1 chain;Laminin-1 subunit beta;Laminin-10 subunit beta;Laminin-12 subunit beta;Laminin-2 subunit beta;Laminin-6 subunit beta;Laminin-8 subunit beta
Relevance: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during bryonic development by interacting with other Extracellular domain matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basent mbrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.
Reference: Isolation of a cDNA clone for the human laminin-B1 chain and its gene localization.Jaye M., Modi W.S., Ricca G.A., Mudd R., Chiu I.M., O'Brien S.J., Drohan W.N.Am. J. Hum. Genet. 41:605-615(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.