Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: P09912
Gene Names: IFI6
Organism: Homo sapiens (Human)
AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
Expression Region: 24-130aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
MW: 24.4 kDa
Alternative Name(s): Interferon-induced protein 6-16
Relevance:
Reference: "Inhibition of G1P3 expression found in the differential display study on respiratory syncytial virus infection." Zhao D., Peng D., Li L., Zhang Q., Zhang C. Virol. J. 5:114-114(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.