Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Signal Transduction
Uniprot ID: O14793
Gene Names: MSTN
Organism: Homo sapiens (Human)
AA Sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Expression Region: 267-375aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 16.4 kDa
Alternative Name(s): Myostatin
Relevance: Acts specifically as a negative regulator of skeletal muscle growth.
Reference: Double muscling in cattle due to mutations in the myostatin gene.McPherron A.C., Lee S.-J.Proc. Natl. Acad. Sci. U.S.A. 94:12457-12461(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.