Recombinant Human Glutaminase kidney isoform, mitochondrial(GLS),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Glutaminase kidney isoform, mitochondrial(GLS),partial

CSB-EP009528HU(F1)
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: O94925

Gene Names: GLS

Organism: Homo sapiens (Human)

AA Sequence: KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL

Expression Region: 616-669aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 33.3 kDa

Alternative Name(s): K-glutaminase L-glutamine amidohydrolase

Relevance: Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.

Reference: "Cloning and analysis of unique human glutaminase isoforms generated by tissue-specific alternative splicing."Elgadi K.M., Meguid R.A., Qian M., Souba W.W., Abcouwer S.F.Physiol. Genomics 1:51-62(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share