Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: Q99747
Gene Names: NAPG
Organism: Homo sapiens (Human)
AA Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
Expression Region: 1-312aa
Sequence Info: Full Length of BC001889
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 61.7 kDa
Alternative Name(s): N-ethylmaleimide-sensitive factor attachment protein gamma
Relevance: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
Reference: "Regulated secretion in platelets: identification of elements of the platelet exocytosis machinery." Lemons P.P., Chen D., Bernstein A.M., Bennett M.K., Whiteheart S.W. Blood 90:1490-1500(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.