Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: P19957
Gene Names: PI3
Organism: Homo sapiens (Human)
AA Sequence: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Expression Region: 61-117aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 8 kDa
Alternative Name(s): Elastase-specific inhibitor ;ESIPeptidase inhibitor 3 ;PI-3;Protease inhibitor WAP3Skin-derived antileukoproteinase ;SKALPWAP four-disulfide core domain protein 14
Relevance: Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
Reference: Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment.Saheki T., Ito F., Hagiwara H., Saito Y., Kuroki J., Tachibana S., Hirose S.Biochem. Biophys. Res. Commun. 185:240-245(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.