
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Transcription
Uniprot ID: P18146
Gene Names: EGR1
Organism: Homo sapiens (Human)
AA Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Expression Region: 444-543aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 12.1 kDa
Alternative Name(s): AT225Nerve growth factor-induced protein A ;NGFI-ATranscription factor ETR103Transcription factor Zif268Zinc finger protein 225Zinc finger protein Krox-24
Relevance: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
Reference: cDNA sequence of the human cellular early growth response gene Egr-1.Suggs S.V., Katzowitz J.L., Tsai-Morris C.-H., Sukhatme V.P.Nucleic Acids Res. 18:4283-4283(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.