
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Apoptosis
Uniprot ID: P99999
Gene Names: CYCS
Organism: Homo sapiens (Human)
AA Sequence: GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Expression Region: 2-105aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 38.6 kDa
Alternative Name(s):
Relevance: Electron carrier protein. The oxidized form of the cytochrome c he group can accept an electron from the he group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.Plays a role in apoptosis. Suppression of the anti-apoptotic mbers or activation of the pro-apoptotic mbers of the Bcl-2 family leads to altered mitochondrial mbrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.
Reference: The human somatic cytochrome c gene two classes of processed pseudogenes demarcate a period of rapid molecular evolution.Evans M.J., Scarpulla R.C.Proc. Natl. Acad. Sci. U.S.A. 85:9625-9629(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.