Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: P55273
Gene Names: CDKN2D
Organism: Homo sapiens (Human)
AA Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Expression Region: 1-166aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 44.7 kDa
Alternative Name(s): p19-INK4d
Relevance: Interacts strongly with CDK4 and CDK6 and inhibits them
Reference: "Mutation testing in melanoma families: INK4A, CDK4 and INK4D." Newton Bishop J.A., Harland M., Bennett D.C., Bataille V., Goldstein A.M., Tucker M.A., Ponder B.A.J., Cuzick J., Selby P., Bishop D.T. Br. J. Cancer 80:295-300(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.