Recombinant Human CMRF35-like molecule 7(CD300LB)

Recombinant Human CMRF35-like molecule 7(CD300LB)

CSB-YP004919HU
Regular price
$791.85 CAD
Sale price
$791.85 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: A8K4G0

Gene Names: CD300LB

Organism: Homo sapiens (Human)

AA Sequence: IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Expression Region: 18-151aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 17.2 kDa

Alternative Name(s): CD300 antigen-like family member B CMRF35-A2 Immune receptor expressed on myeloid cells 3 Short name: IREM-3 Leukocyte mono-Ig-like receptor 5 Triggering receptor expressed on myeloid cells 5 Short name: TREM-5 CD_antigen: CD300b

Relevance: Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Reference: "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share