
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q14839
Gene Names: CHD4
Organism: Homo sapiens (Human)
AA Sequence: MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFK
Expression Region: 1-219aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 28.9 kDa
Alternative Name(s): ATP-dependent helicase CHD4Mi-2 autoantigen 218KDA protein;Mi2-beta
Relevance: Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones.
Reference: The major dermatomyositis specific Mi-2 autoantigen is a presumed helicase involved in transcriptional activation.Seelig H.P., Moosbrugger I., Ehrfeld H., Fink T., Renz M., Genth E.Arthritis Rheum. 38:1389-1399(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.