
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Developmental Biology
Uniprot ID: P18075
Gene Names: BMP7
Organism: Homo sapiens (Human)
AA Sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Expression Region: 293-431aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 42.7 kDa
Alternative Name(s): Osteogenic protein 1 ;OP-1INN: Eptotermin alfa
Relevance: Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Reference: Expression and characterization of a human BMP-7 variant with improved biochemical properties.Swencki-Underwood B., Mills J.K., Vennarini J., Boakye K., Luo J., Pomerantz S., Cunningham M.R., Farrell F.X., Naso M.F., Amegadzie B.Protein Expr. Purif. 57:312-319(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.