Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: Q8IZY5
Gene Names: BLID
Organism: Homo sapiens (Human)
AA Sequence: MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Expression Region: 1-108aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 39 kDa
Alternative Name(s): Breast cancer cell protein 2
Relevance: Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Reference: "BRCC2, a novel BH3-like domain-containing protein, induces apoptosis in a caspase-dependent manner." Broustas C.G., Gokhale P.C., Rahman A., Dritschilo A., Ahmad I., Kasid U. J. Biol. Chem. 279:26780-26788(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.