Recombinant Human Atypical chemokine receptor 3(ACKR3),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Atypical chemokine receptor 3(ACKR3),partial

CSB-EP006257HU
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P25106

Gene Names: ACKR3

Organism: Homo sapiens (Human)

AA Sequence: MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

Expression Region: 1-40aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 20.5 kDa

Alternative Name(s): C-X-C chemokine receptor type 7 Short name: CXC-R7 Short name: CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name: RDC-1

Relevance: Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.

Reference: "Cloning and expression of the human vasoactive intestinal peptide receptor."Sreedharan S.P., Robichon A., Peterson K.E., Goetzl E.J.Proc. Natl. Acad. Sci. U.S.A. 88:4986-4990(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share