
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Transport
Uniprot ID: P55087
Gene Names: AQP4
Organism: Homo sapiens (Human)
AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Expression Region: 253-323aa
Sequence Info: Cytoplasmic Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 10 kDa
Alternative Name(s): Mercurial-insensitive water channel ;MIWCWCH4
Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous syst.
Reference: Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.Ho J.D., Yeh R., Sandstrom A., Chorny I., Harries W.E., Robbins R.A., Miercke L.J., Stroud R.M.Proc. Natl. Acad. Sci. U.S.A. 106:7437-7442(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.