Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Others
Uniprot ID: Q96IZ2
Gene Names: ADTRP
Organism: Homo sapiens (Human)
AA Sequence: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Expression Region: 1-230aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 31.8 kDa
Alternative Name(s): C6orf105
Relevance: Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells
Reference: "Associations between the CDKN2A/B, ADTRP and PDGFD polymorphisms and the development of coronary atherosclerosis in Japanese patients." Dechamethakun S., Ikeda S., Arai T., Sato N., Sawabe M., Muramatsu M. J. Atheroscler. Thromb. 21:680-690(2014)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.