Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P0C6G6
Gene Names: PMP2
Organism: Equus caballus (Horse)
AA Sequence: SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV
Expression Region: 2-132aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 30.4 kDa
Alternative Name(s):
Relevance: May play a role in lipid transport protein in Schwann cells. May bind cholesterol.
Reference: "Structure of myelin P2 protein from equine spinal cord."Hunter D.J., Macmaster R., Roszak A.W., Riboldi-Tunnicliffe A., Griffiths I.R., Freer A.A.Acta Crystallogr. D 61:1067-1071(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.