Recombinant Horse Myelin P2 protein(PMP2)

Recombinant Horse Myelin P2 protein(PMP2)

CSB-EP315130HO
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0C6G6

Gene Names: PMP2

Organism: Equus caballus (Horse)

AA Sequence: SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV

Expression Region: 2-132aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 30.4 kDa

Alternative Name(s):

Relevance: May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Reference: "Structure of myelin P2 protein from equine spinal cord."Hunter D.J., Macmaster R., Roszak A.W., Riboldi-Tunnicliffe A., Griffiths I.R., Freer A.A.Acta Crystallogr. D 61:1067-1071(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share