Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: P28585
Gene Names: bla
Organism: Escherichia coli
AA Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
Expression Region: 29-291aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: C-terminal 6xHis-tagged
MW: 30.2 kDa
Alternative Name(s): Beta-lactamase MEN-1 Cefotaximase 1 men1
Relevance: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.
Reference: "Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1) and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases." Bauernfeind A., Stemplinger I., Jungwirth R., Casellas J.M. Antimicrob. Agents Chemother. 40:509-513(1996)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.