Recombinant Dog Cationic trypsin

Recombinant Dog Cationic trypsin

CSB-CF361971DO
Regular price
$821.11 CAD
Sale price
$821.11 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: P06871

Gene Names: N/A

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Expression Region: 24-246aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.6 kDa

Alternative Name(s):

Relevance:

Reference: "Differential regulation of trypsinogen mRNA translation: full-length mRNA sequences encoding two oppositely charged trypsinogen isoenzymes in the dog pancreas."Pinsky S.D., Laforge K.S., Scheele G.Mol. Cell. Biol. 5:2669-2676(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share