Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: P41547
Gene Names: CALCA
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence: CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP
Expression Region: 85-116aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 19.4 kDa
Alternative Name(s):
Relevance: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Reference: "Molecular analysis and chromosomal assignment of the canine CALC-I/alpha-CGRP gene."Wende S., Krempler A., Breen M., Brunnberg L., Brenig B.Mamm. Genome 11:736-740(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.