Recombinant Dog Calcitonin(CALCA)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Dog Calcitonin(CALCA)

CSB-EP004434DO
Regular price
$1,151.28 CAD
Sale price
$1,151.28 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: P41547

Gene Names: CALCA

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP

Expression Region: 85-116aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 19.4 kDa

Alternative Name(s):

Relevance: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Reference: "Molecular analysis and chromosomal assignment of the canine CALC-I/alpha-CGRP gene."Wende S., Krempler A., Breen M., Brunnberg L., Brenig B.Mamm. Genome 11:736-740(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share