Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: A7L035
Gene Names: N/A
Organism: Chironex fleckeri (Box jellyfish)
AA Sequence: EQSDQELQEALYGVKREYAVSKAFLDGVRNETSDLSPTEVSALAANVPIYQGVRFIAMVVQRIKYIKPKTESEIKRMLTMLELFTDLCSLRDLILLDLYQLVATPGHSPNIASGIKEVSNLGREEYKKVFEDLLKNDDKETYLFLSYLYPREKNEQSRKIFNFFDLMKVKYDDRLKQDLTGVKIFSNVHWPNYFMCSSNDYLALICTKPYGSLKLDKLNDGYYSIKTTQHDPKICHRYGNYILFTHKRNDDLEKFNFVPVKLEKREIYLLSSKESPNKFAYVPQNADGALFFVDGIPSKVGYGNQGYFTLVE
Expression Region: 145-456aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 52.2 kDa
Alternative Name(s):
Relevance: Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells
Reference: "Identification, cloning and sequencing of two major venom proteins from the box jellyfish, Chironex fleckeri." Brinkman D., Burnell J. Toxicon 50:850-860(2007)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.