Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P14916
Gene Names: ureA
Organism: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
AA Sequence: MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
Expression Region: 1-238aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 28.5 kDa
Alternative Name(s): Urea amidohydrolase subunit alpha
Relevance: Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.
Reference: Identification of the urease operon in Helicobacter pylori and its control by mRNA decay in response to pH.Akada J.K., Shirai M., Takeuchi H., Tsuda M., Nakazawa T.Mol. Microbiol. 36:1071-1084(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.