Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Uniprot NO.:Q8KQC3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ANSASSLGNVDSVLQNIVTMMTGTTAKLIAIICVAAVGIGWMSGFIDLRKAAYCILGIGI VFGAPTLVSTLMGSS
Protein Names:Recommended name: Type IV secretion system protein virB2
Gene Names:Name:virB2 Ordered Locus Names:BQ10530
Expression Region:30-104
Sequence Info:full length protein