Recombinant Bacillus subtilis  Negative regulatory protein yxlE(yxlE)

Recombinant Bacillus subtilis Negative regulatory protein yxlE(yxlE)

CSB-CF310146BRJ
Regular price
$1,400.00 CAD
Sale price
$1,400.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P94373

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNISWEMILPLIVLQLALAVFALISCIKEERTNGPKWMWAAIIVCINIIGPILFFTVGRK QR

Protein Names:Recommended name: Negative regulatory protein yxlE

Gene Names:Name:yxlE Ordered Locus Names:BSU38670

Expression Region:1-62

Sequence Info:full length protein

Your list is ready to share