Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus pseudofirmus (strain OF4)
Uniprot NO.:Q9RGZ0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFQSILMIVLVVMSISLFVCFIRTLIGPTMSDRIVALDTFGINLIGFIGVIMMLQETLAY SEVVLVISILAFIGSIALSKFIERGVVFDRG
Protein Names:Recommended name: Na(+)/H(+) antiporter subunit F Alternative name(s): Mrp complex subunit F Multiple resistance and pH homeostasis protein F
Gene Names:Name:mrpF Ordered Locus Names:BpOF4_13185
Expression Region:1-91
Sequence Info:full length protein