Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: O52195
Gene Names: algL
Organism: Azotobacter vinelandii
AA Sequence: AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD
Expression Region: 24-374aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 59 kDa
Alternative Name(s): Poly(beta-D-mannuronate) lyase
Relevance: Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues. May serve to degrade mislocalized alginate that is trapped in the periplasmic space
Reference: "Biochemical properties and substrate specificities of a recombinantly produced Azotobacter vinelandii alginate lyase." Ertesvag H., Erlien F., Skjak-Braek G., Rehm B.H., Valla S. J. Bacteriol. 180:3779-3784(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.