Recombinant  Uncharacterized protein yfgG(yfgG)

Recombinant Uncharacterized protein yfgG(yfgG)

CSB-CF354326SZB
Regular price
$1,064.00 USD
Sale price
$1,064.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P64547

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQATSMRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESP VQR

Protein Names:Recommended name: Uncharacterized protein yfgG

Gene Names:Name:yfgG Ordered Locus Names:SF2550, S2700

Expression Region:1-63

Sequence Info:full length protein