Recombinant  Uncharacterized membrane protein yhzF(yhzF)

Recombinant Uncharacterized membrane protein yhzF(yhzF)

CSB-CF498727BRI
Regular price
$1,055.00 USD
Sale price
$1,055.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis

Uniprot NO.:C0H3Y3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTK LLA

Protein Names:Recommended name: Uncharacterized membrane protein yhzF

Gene Names:Name:yhzF Ordered Locus Names:BSU10009

Expression Region:1-63

Sequence Info:full length protein

Your list is ready to share