Recombinant Polystichum munitum  Chlorophyll a-b binding protein type 1 member F3, chloroplastic(CABF3)

Recombinant Polystichum munitum Chlorophyll a-b binding protein type 1 member F3, chloroplastic(CABF3)

CSB-CF323607PPC
Regular price
$1,174.00 USD
Sale price
$1,174.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Polystichum munitum (Western swordfern) (Aspidium munitum)

Uniprot NO.:P15195

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPKSKAPSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRE LEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPSLVHAQS ILAIWACQVILMGAVEGYRVAGGPLGEVEDPIYPGGSFDPLGLADDPEAFAELKVKELKN GRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPAVNNAWAYATNFTPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein type 1 member F3, chloroplastic Alternative name(s): Chlorophyll a-b binding protein type I F3 Short name= CAB-F3 LHCP

Gene Names:Name:CABF3

Expression Region:37-265

Sequence Info:full length protein