Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Vascular endothelial growth factor A(VEGFA)

Recombinant Pig Vascular endothelial growth factor A(VEGFA)

SKU:CSB-EP025833PI

Regular price $1,114.00 USD
Regular price Sale price $1,114.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: VEGFA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Sus scrofa (Pig)

Delivery time: 3-7 business days

Uniprot ID: P49151

AA Sequence: APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Tag info: N-terminal 6xHis-tagged

Expression Region: 27-190aa

Protein length: Full Length

MW: 23.2 kDa

Alternative Name(s): Vascular permeability factor ;VPF

Relevance: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin .

Reference: Nucleotide sequence and expression of the porcine vascular endothelial growth factor.Sharma H.S., Tang Z.H., Gho B.C.H., Verdouw P.D.Biochim. Biophys. Acta 1260:235-238(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details